PDB entry 2nl9

View 2nl9 on RCSB PDB site
Description: Crystal structure of the Mcl-1:Bim BH3 complex
Class: apoptosis
Keywords: Apoptosis, Bcl-2, Mcl-1, Bim
Deposited on 2006-10-19, released 2007-03-27
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.174
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: FUSION PROTEIN CONSISTING OF Induced myeloid leukemia cell differentiation protein Mcl-1 homolog
    Species: Rattus norvegicus, Homo sapiens [TaxId:10116,9606]
    Gene: MCL1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2nl9a_
  • Chain 'B':
    Compound: Bcl-2-like protein 11
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ZN, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2nl9A (A:)
eddlyrqsleiisrylreqatgskdskplgeagaagrraletlrrvgdgvqrnhetafqg
mlrkldikneddvkslsrvmihvfsdgvtnwgrivtlisfgafvakhlktinqesciepl
aesitdvlvrtkrdwlvkqrgwdgfveffhvedlegg

    Sequence, based on observed residues (ATOM records): (download) 
    >2nl9A (A:)
ddlyrqsleiisrylreqatgsgaagrraletlrrvgdgvqrnhetafqgmlrkldikne
ddvkslsrvmihvfsdgvtnwgrivtlisfgafvakhlktinqescieplaesitdvlvr
tkrdwlvkqrgwdgfveffhve

  • Chain 'B':
    No sequence available.