PDB entry 2nl8

View 2nl8 on RCSB PDB site
Description: The origin binding domain of the SV40 large T antigen bound non specifically to a 17 bp palindrome DNA (sites 1 and 3)
Class: DNA binding protein/DNA
Keywords: DNA binding protein, DNA binding protein/DNA COMPLEX
Deposited on 2006-10-19, released 2006-12-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-19.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.24
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: large t antigen
    Species: Simian virus 40 [TaxId:10633]
    Gene: large T antigen
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03070
      • engineered (89)
    Domains in SCOPe 2.07: d2nl8a_
  • Chain 'W':
    Compound: 18-nt PEN element of the SV40 DNA origin
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2nl8A (A:)
    gshmkvedpkdfpsellsflshavfsnrtlacfaiyttkekaallykkimekysvtfisr
    hnsynhnilffltphrhrvsainnyaqklstfsflickgvnkeylmysaltrdpfsviee
    slpgglkehdfnp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nl8A (A:)
    edpkdfpsellsflshavfsnrtlacfaiyttkekaallykkimekysvtfisrhnsynh
    nilffltphrhrvsainnyaqklstfsflickgvnkeylmysaltrdpfsvieeslp
    

  • Chain 'W':
    No sequence available.