PDB entry 2nl8
View 2nl8 on RCSB PDB site
Description: The origin binding domain of the SV40 large T antigen bound non specifically to a 17 bp palindrome DNA (sites 1 and 3)
Class: DNA binding protein/DNA
Keywords: DNA binding protein, DNA binding protein/DNA COMPLEX
Deposited on
2006-10-19, released
2006-12-12
The last revision prior to the SCOPe 2.05 freeze date was dated
2009-02-24, with a file datestamp of
2009-02-19.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.24
AEROSPACI score: 0.3
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: large t antigen
Species: Simian virus 40 [TaxId:10633]
Gene: large T antigen
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.05: d2nl8a_ - Chain 'W':
Compound: 18-nt PEN element of the SV40 DNA origin
- Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>2nl8A (A:)
gshmkvedpkdfpsellsflshavfsnrtlacfaiyttkekaallykkimekysvtfisr
hnsynhnilffltphrhrvsainnyaqklstfsflickgvnkeylmysaltrdpfsviee
slpgglkehdfnp
Sequence, based on observed residues (ATOM records): (download)
>2nl8A (A:)
edpkdfpsellsflshavfsnrtlacfaiyttkekaallykkimekysvtfisrhnsynh
nilffltphrhrvsainnyaqklstfsflickgvnkeylmysaltrdpfsvieeslp
- Chain 'W':
No sequence available.