PDB entry 2nip

View 2nip on RCSB PDB site
Description: nitrogenase iron protein from azotobacter vinelandii
Class: iron protein
Keywords: iron protein, oxidoreductase
Deposited on 1998-05-11, released 1998-11-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-03-24, with a file datestamp of 2009-03-20.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.223
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nitrogenase iron protein
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2nipa_
  • Chain 'B':
    Compound: nitrogenase iron protein
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2nipb_
  • Heterogens: SF4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2nipA (A:)
    amrqcaiygkggigkstttqnlvaalaemgkkvmivgcdpkadstrlilhskaqntimem
    aaeagtvedleledvlkagyggvkcvesggpepgvgcagrgvitainfleeegayeddld
    fvfydvlgdvvcggfampirenkaqeiyivcsgemmamyaanniskgivkyansgsvrlg
    glicnsrntdredeliialanklgtqmihfvprdnvvqraeirrmtvieydpkakqadey
    ralarkvvdnkllvipnpitmdeleellmefgimevedesivgktaeev
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nipA (A:)
    amrqcaiygkggigkstttqnlvaalaemgkkvmivgcdpkadstrlilhskaqntimem
    aaeagtvedleledvlkagyggvkcvesggpepgvgcagrgvitainfleeegayeddld
    fvfydvlgdvvcggfampirenkaqeiyivcsgemmamyaanniskgivkyansgsvrlg
    glicnsrntdredeliialanklgtqmihfvprdnvvqraeirrmtvieydpkakqadey
    ralarkvvdnkllvipnpitmdeleellmefgimevedesivgkta
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2nipB (B:)
    amrqcaiygkggigkstttqnlvaalaemgkkvmivgcdpkadstrlilhskaqntimem
    aaeagtvedleledvlkagyggvkcvesggpepgvgcagrgvitainfleeegayeddld
    fvfydvlgdvvcggfampirenkaqeiyivcsgemmamyaanniskgivkyansgsvrlg
    glicnsrntdredeliialanklgtqmihfvprdnvvqraeirrmtvieydpkakqadey
    ralarkvvdnkllvipnpitmdeleellmefgimevedesivgktaeev