PDB entry 2ngr

View 2ngr on RCSB PDB site
Description: transition state complex for GTP hydrolysis by cdc42: comparisons of the high resolution structures for cdc42 bound to the active and catalytically compromised forms of the cdc42-gap.
Class: hydrolase
Keywords: transition state, g-protein, gap, cdc42, alf3., hydrolase
Deposited on 1998-07-31, released 1999-01-06
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.253
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (GTP binding protein (g25k))
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2ngra_
  • Chain 'B':
    Compound: protein (gtpase activating protein (rhg))
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q07960
      • mutation (76)
    Domains in SCOPe 2.01: d2ngrb_
  • Heterogens: MG, GDP, AF3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ngrA (A:)
    mqtikcvvvgdgavgktcllisyttnkfpseyvptvfdnyavtvmiggepytlglfdtag
    qedydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqidlr
    ddpstieklaknkqkpitpetaeklardlkavkyvecsaltqkglknvfdeailaalepp
    epkksrrcvll
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ngrB (B:)
    iprqvlkyddflkstqkspatapkpmpprpplpnqqfgvslqhlqeknpeqepipivlre
    tvaylqahalttegifarsantqvvrevqqkynmglpvdfdqynelhlpavilktflrel
    peplltfdlyphvvgflnidesqrvpatlqvlqtlpeenyqvlrfltaflvqisahsdqn
    kmtntnlavvfgpnllwakdaaitlkainpintftkflldhqgelfpspdpsgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ngrB (B:)
    lpnqqfgvslqhlqeknpeqepipivlretvaylqahalttegifarsantqvvrevqqk
    ynmglpvdfdqynelhlpavilktflrelpeplltfdlyphvvgflnidesqrvpatlqv
    lqtlpeenyqvlrfltaflvqisahsdqnkmtntnlavvfgpnllwakdaaitlkainpi
    ntftkflldhqgelfp