PDB entry 2ndp

View 2ndp on RCSB PDB site
Description: Structure of DNA-binding HU protein from micoplasma Mycoplasma gallisepticum
Class: DNA binding protein
Keywords: Histone-like protein, DNA BINDING PROTEIN
Deposited on 2016-09-13, released 2016-11-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-11-09, with a file datestamp of 2016-11-04.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histone-like DNA-binding superfamily protein
    Species: Mycoplasma gallisepticum S6 [TaxId:1006581]
    Gene: hup_2, GCW_02335
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ndpa_
  • Chain 'B':
    Compound: Histone-like DNA-binding superfamily protein
    Species: Mycoplasma gallisepticum S6 [TaxId:1006581]
    Gene: hup_2, GCW_02335
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ndpb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ndpA (A:)
    makikslsaaeylkemadetnikvqdirlvvtslqkvlakelattgevrlfdigkfklvt
    tkprtginpktkqkiqipagkkikltvskiltdavdshk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ndpB (B:)
    makikslsaaeylkemadetnikvqdirlvvtslqkvlakelattgevrlfdigkfklvt
    tkprtginpktkqkiqipagkkikltvskiltdavdshk