PDB entry 2ndo

View 2ndo on RCSB PDB site
Description: Structure of EcDsbA-sulfonamide1 complex
Class: oxidoreductases
Keywords: Oxidised EcDsbA, Sulfonamide, OXIDOREDUCTASES
Deposited on 2016-08-22, released 2017-02-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-02-08, with a file datestamp of 2017-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thiol:disulfide interchange protein dsbA
    Species: Escherichia coli K-12 [TaxId:83333]
    Gene: dsbA, dsf, ppfA, b3860, JW3832
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2ndoa_
  • Heterogens: SFQ

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ndoA (A:)
    aqyedgkqyttlekpvagapqvleffsffcphcyqfeevlhisdnvkkklpegvkmtkyh
    vnfmggdlgkdltqawavamalgvedkvtvplfegvqktqtirsasdirdvfinagikge
    eydaawnsfvvkslvaqqekaaadvqlrgvpamfvngkyqlnpqgmdtsnmdvfvqqyad
    tvkylsekk