PDB entry 2ncm

View 2ncm on RCSB PDB site
Description: neural cell adhesion molecule, nmr, 20 structures
Class: cell adhesion
Keywords: cell adhesion, glycoprotein, heparin-binding, gpi-anchor, neural adhesion molecule, immunoglobulin fold
Deposited on 1996-12-16, released 1997-03-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: neural cell adhesion molecule
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ncma_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ncmA (A:)
    rvlqvdivpsqgeisvgeskfflcqvagdakdkdiswfspngeklspnqqrisvvwnddd
    sstltiynaniddagiykcvvtaedgtqseatvnvkifq