PDB entry 2nck

View 2nck on RCSB PDB site
Description: crystal structure of myxococcus xanthus nucleoside diphosphate kinase and its interaction with a nucleotide substrate at 2.0 angstroms resolution
Class: phosphotransferase(po4 as acceptor)
Keywords: phosphotransferase(po4 as acceptor)
Deposited on 1993-11-15, released 1994-01-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'L':
    Compound: Nucleoside diphosphate kinase
    Species: MYXOCOCCUS XANTHUS [TaxId:34]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2nckl_
  • Chain 'R':
    Compound: Nucleoside diphosphate kinase
    Species: MYXOCOCCUS XANTHUS [TaxId:34]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2nckr_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2nckL (L:)
    aiertlsiikpdglekgvigkiisrfeekglkpvairlqhlsqaqaegfyavhkarpffk
    dlvqfmisgpvvlmvlegenavlanrdimgatnpaqaaegtirkdfatsidkntvhgsds
    lenakieiayffreteihsypyqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nckL (L:)
    aiertlsiikpdglekgvigkiisrfeekglkpvairlqhlsqaqaegfyavhkarpffk
    dlvqfmisgpvvlmvlegenavlanrdimgatnpaqaaegtirkdfatsidkntvhgsds
    lenakieiayffreteihsypyq
    

  • Chain 'R':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2nckR (R:)
    aiertlsiikpdglekgvigkiisrfeekglkpvairlqhlsqaqaegfyavhkarpffk
    dlvqfmisgpvvlmvlegenavlanrdimgatnpaqaaegtirkdfatsidkntvhgsds
    lenakieiayffreteihsypyqk