PDB entry 2ncd

View 2ncd on RCSB PDB site
Description: ncd (non-claret disjunctional) dimer from d. melanogaster
Class: contractile protein
Keywords: kinesin, microtubule-based motor, ncd, contractile protein
Deposited on 1999-06-04, released 1999-06-09
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.226
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: PROTEIN (Kinesin motor NCD)
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: NCD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2ncda_
  • Heterogens: SO4, ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ncdA (A:)
    elqaihekvktehaalstevvhlrqrteellrcneqqaaeletckeqlfqsnmerkelhn
    tvmdlrgnirvfcrirppleseenrmcctwtyhdestvelqsidaqakskmgqqifsfdq
    vfhplssqsdifemvspliqsaldgynicifaygqtgsgktytmdgvpesvgviprtvdl
    lfdsirgyrnlgweyeikatfleiynevlydllsneqkdmeirmaknnkndiyvsnitee
    tvldpnhlrhlmhtakmnratastagnerssrshavtkleligrhaekqeisvgsinlvd
    lagsespktstrmtetkninrslseltnvilallqkqdhipyrnsklthllmpslggnsk
    tlmfinvspfqdcfqesvkslrfaasvnsckmtkakrnrylnnsvansstqsnnsgsfdk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ncdA (A:)
    lrqrteellrcneqqaaeletckeqlfqsnmerkelhntvmdlrgnirvfcrirpplese
    enrmcctwtyhdestvelqsidaqakskmgqqifsfdqvfhplssqsdifemvspliqsa
    ldgynicifaygqtgsgktytmdgvpesvgviprtvdllfdsirgyrnlgweyeikatfl
    eiynevlydllsneqkdmeirmaknnkndiyvsniteetvldpnhlrhlmhtakmnrata
    stagnerssrshavtkleligrhaekqeisvgsinlvdlagsespninrslseltnvila
    llqkqdhipyrnsklthllmpslggnsktlmfinvspfqdcfqesvkslrfaasvnsc