PDB entry 2ncd

View 2ncd on RCSB PDB site
Description: ncd (non-claret disjunctional) dimer from d. melanogaster
Deposited on 1999-06-04, released 1999-06-09
The last revision prior to the SCOP 1.57 freeze date was dated 1999-06-09, with a file datestamp of 1999-06-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.226
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d2ncda_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ncdA (A:)
    lrqrteellrcneqqaaeletckeqlfqsnmerkelhntvmdlrgnirvfcrirpplese
    enrmcctwtyhdestvelqsidaqakskmgqqifsfdqvfhplssqsdifemvspliqsa
    ldgynicifaygqtgsgktytmdgvpesvgviprtvdllfdsirgyrnlgweyeikatfl
    eiynevlydllsneqkdmeirmaknnkndiyvsniteetvldpnhlrhlmhtakmnrata
    stagnerssrshavtkleligrhaekqeisvgsinlvdlagsespktstrmtetkninrs
    lseltnvilallqkqdhipyrnsklthllmpslggnsktlmfinvspfqdcfqesvkslr
    faasvnsc
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ncdA (A:)
    lrqrteellrcneqqaaeletckeqlfqsnmerkelhntvmdlrgnirvfcrirpplese
    enrmcctwtyhdestvelqsidaqakskmgqqifsfdqvfhplssqsdifemvspliqsa
    ldgynicifaygqtgsgktytmdgvpesvgviprtvdllfdsirgyrnlgweyeikatfl
    eiynevlydllsneqkdmeirmaknnkndiyvsniteetvldpnhlrhlmhtakmnrata
    stagnerssrshavtkleligrhaekqeisvgsinlvdlagsespninrslseltnvila
    llqkqdhipyrnsklthllmpslggnsktlmfinvspfqdcfqesvkslrfaasvnsc