PDB entry 2nc9

View 2nc9 on RCSB PDB site
Description: Apo solution structure of Hop TPR2A
Class: chaperone
Keywords: chaperone, heat-shock, Hsp90, TPR
Deposited on 2016-03-23, released 2017-03-29
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-03-29, with a file datestamp of 2017-03-24.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Stress-induced-phosphoprotein 1
  Species: Homo sapiens [TaxId:9606]
  Gene: STIP1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P31948 (0-130)
  Domains in SCOPe 2.06: d2nc9a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2nc9A (A:)
  enkkqalkekelgndaykkkdfdtalkhydkakeldptnmtyitnqaavyfekgdynkcr
  elcekaievgrenredyrqiakayarignsyfkeekykdaihfynkslaehrtpdvlkkc
  qqaekilkeqe