PDB entry 2nc9

View 2nc9 on RCSB PDB site
Description: Apo solution structure of Hop TPR2A
Class: chaperone
Keywords: chaperone, heat-shock, Hsp90, TPR
Deposited on 2016-03-23, released 2017-03-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-10-28, with a file datestamp of 2020-10-23.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Stress-induced-phosphoprotein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: STIP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2nc9a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2nc9A (A:)
    enkkqalkekelgndaykkkdfdtalkhydkakeldptnmtyitnqaavyfekgdynkcr
    elcekaievgrenredyrqiakayarignsyfkeekykdaihfynkslaehrtpdvlkkc
    qqaekilkeqe