PDB entry 2nbw

View 2nbw on RCSB PDB site
Description: Solution structure of the Rpn1 T1 site with the Rad23 UBL domain
Class: protein binding
Keywords: protein binding
Deposited on 2016-03-14, released 2016-07-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-08-17, with a file datestamp of 2016-08-12.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: 26s proteasome regulatory subunit rpn1
  Species: Saccharomyces cerevisiae S288c [TaxId:559292]
  Gene: RPN1, HRD2, NAS1, RPD1, YHR027C
  Database cross-references and differences (RAF-indexed):
  • Uniprot P38764 (0-130)
• Chain 'B':
  Compound: UV excision repair protein RAD23
  Species: Saccharomyces cerevisiae S288c [TaxId:559292]
  Gene: RAD23, YEL037C, SYGP-ORF29
  Database cross-references and differences (RAF-indexed):
  • Uniprot P32628 (0-77)
  Domains in SCOPe 2.07: d2nbwb_

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2nbwB (B:)
  mvsltfknfkkekvpldlepsntiletktklaqsisceesqikliysgkvlqdsktvsec
  glkdgdqvvfmvsqkkst