PDB entry 2nbu

View 2nbu on RCSB PDB site
Description: Solution structure of the Rad23 ubiquitin-like (UBL) domain
Class: DNA binding protein
Keywords: DNA binding protein
Deposited on 2016-03-12, released 2016-07-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-08-17, with a file datestamp of 2016-08-12.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: UV excision repair protein RAD23
    Species: Saccharomyces cerevisiae S288c [TaxId:559292]
    Gene: RAD23, YEL037C, SYGP-ORF29
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2nbua_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2nbuA (A:)
mvsltfknfkkekvpldlepsntiletktklaqsisceesqikliysgkvlqdsktvsec
glkdgdqvvfmvsqkkstdpnsssvdklaaalehhhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >2nbuA (A:)
mvsltfknfkkekvpldlepsntiletktklaqsisceesqikliysgkvlqdsktvsec
glkdgdqvvfmvsqkkst