PDB entry 2nbt

View 2nbt on RCSB PDB site
Description: neuronal bungarotoxin, nmr, 10 structures
Deposited on 1997-10-29, released 1998-03-11
The last revision prior to the SCOP 1.55 freeze date was dated 1998-03-11, with a file datestamp of 1998-03-11.
Experiment type: NMR10
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d2nbta_
  • Chain 'B':
    Domains in SCOP 1.55: d2nbtb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2nbtA (A:)
rtclispsstpqtcpngqdicflkaqcdkfcsirgpvieqgcvatcpqfrsnyrsllcct
tdncnh

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2nbtB (B:)
rtclispsstpqtcpngqdicflkaqcdkfcsirgpvieqgcvatcpqfrsnyrsllcct
tdncnh