PDB entry 2nbr

View 2nbr on RCSB PDB site
Description: The Solution Structure of Human gammaC-crystallin
Class: structural protein
Keywords: Human gammaC-crystallin, STRUCTURAL PROTEIN
Deposited on 2016-03-12, released 2016-06-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-06-07, with a file datestamp of 2017-06-02.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Gamma-crystallin C
    Species: Homo sapiens [TaxId:9606]
    Gene: CRYGC, CRYG3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2nbra_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2nbrA (A:)
gkitfyedrafqgrsyetttdcpnlqpyfsrcnsirvesgcwmlyerpnyqgqqyllrrg
eypdyqqwmglsdsirscclipqtvshrlrlyeredhkglmmelsedcpsiqdrfhlsei
rslhvlegcwvlyelpnyrgrqyllrpqeyrrcqdwgamdakagslrrvvdly