PDB entry 2nbp

View 2nbp on RCSB PDB site
Description: Solution structure of the T119M variant of transthyretin in its monomeric state
Class: transport protein
Keywords: transthyretin, amyloid, aggregation, monomer, TRANSPORT PROTEIN
Deposited on 2016-03-09, released 2017-05-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-05-10, with a file datestamp of 2017-05-05.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Gene: TTR, PALB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02766 (0-126)
      • engineered mutation (86)
      • engineered mutation (109)
      • engineered mutation (118)
    Domains in SCOPe 2.07: d2nbpa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2nbpA (A:)
    gptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltt
    eeefvegiykveidtksywkalgispmhehaevvftandsgprrytiaamlspysystma
    vvtnpke