PDB entry 2nbo

View 2nbo on RCSB PDB site
Description: Solution structure of the F87M/L110M variant of transthyretin in the monomeric state
Class: transport protein
Keywords: transthyretin, amyloid, aggregation, misfolded, monomer, TRANSPORT PROTEIN
Deposited on 2016-03-09, released 2017-02-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-04-26, with a file datestamp of 2017-04-21.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Gene: TTR, PALB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02766 (0-126)
      • engineered mutation (86)
      • engineered mutation (109)
    Domains in SCOPe 2.07: d2nboa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2nboA (A:)
    gptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltt
    eeefvegiykveidtksywkalgispmhehaevvftandsgprrytiaamlspysystta
    vvtnpke