PDB entry 2nbj

View 2nbj on RCSB PDB site
Description: DNA-archeal MC1 protein complex structure by NMR
Class: DNA binding protein/DNA
Keywords: DNA-protein complex, bent DNA, archaea, DNA BINDING PROTEIN-DNA complex
Deposited on 2016-02-25, released 2017-03-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-03-01, with a file datestamp of 2017-02-24.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chromosomal protein MC1
    Species: Methanosarcina thermophila CHTI-55 [TaxId:1434121]
    Gene: MSTHC_1630
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2nbja_
  • Chain 'B':
    Compound: DNA (5'-d(*ap*ap*ap*ap*ap*cp*ap*cp*ap*cp*ap*cp*cp*cp*a)-3')
  • Chain 'C':
    Compound: DNA (5'-d(p*tp*gp*gp*gp*tp*gp*tp*gp*tp*gp*tp*tp*tp*tp*t)-3')

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2nbjA (A:)
sntrnfvlrdedgnehgvftgkqprqaalkaanrgsgtkanpdiirlrergtkkvhvfka
wkeivdapknrpawmpekiskpfvkkeriekle

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.