PDB entry 2nbd

View 2nbd on RCSB PDB site
Description: Solution structure of V26A mutant of Ubiquitin at pH 6.0
Class: protein binding
Keywords: Ubiquitin, mutant, PROTEIN BINDING
Deposited on 2016-02-04, released 2016-05-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-09-07, with a file datestamp of 2016-09-02.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: entity
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2NBD (0-75)
    Domains in SCOPe 2.07: d2nbda1, d2nbda2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2nbdA (A:)
    mqifvktltgktitlevepsdtienakakiqdkegippdqqrlifagkqledgrtlsdyn
    iqkestlhlvlrlrgg