PDB entry 2nb1

View 2nb1 on RCSB PDB site
Description: P63/p73 hetero-tetramerisation domain
Class: transcription
Keywords: p63, p73, tetramerization domain, hetero tetramer, transcription factor, TRANSCRIPTION
Deposited on 2016-01-19, released 2016-12-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-12-07, with a file datestamp of 2016-12-02.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tumor protein 63
    Species: Homo sapiens [TaxId:9606]
    Gene: KET, P63, P73H, P73L, TP63, TP73L
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9H3D4
      • expression tag (0)
      • engineered mutation (20)
    Domains in SCOPe 2.06: d2nb1a1, d2nb1a2
  • Chain 'B':
    Compound: Tumor protein p73
    Species: Homo sapiens [TaxId:9606]
    Gene: P73, TP73
    Database cross-references and differences (RAF-indexed):
    • Uniprot O15350
      • expression tag (0-1)
      • engineered mutation (14)
  • Chain 'C':
    Compound: Tumor protein 63
    Species: Homo sapiens [TaxId:9606]
    Gene: KET, P63, P73H, P73L, TP63, TP73L
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9H3D4 (1-59)
      • expression tag (0)
      • engineered mutation (20)
    Domains in SCOPe 2.06: d2nb1c1, d2nb1c2
  • Chain 'D':
    Compound: Tumor protein p73
    Species: Homo sapiens [TaxId:9606]
    Gene: P73, TP73
    Database cross-references and differences (RAF-indexed):
    • Uniprot O15350 (2-49)
      • expression tag (0-1)
      • engineered mutation (14)

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2nb1A (A:)
    sddellylpvrgretyemlleikeslelmqylpqhtietyrqqqqqqhqhllqkqtsiqs
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2nb1C (C:)
    sddellylpvrgretyemlleikeslelmqylpqhtietyrqqqqqqhqhllqkqtsiqs
    

  • Chain 'D':
    No sequence available.