PDB entry 2naz

View 2naz on RCSB PDB site
Description: The solution NMR structure of the C-terminal effector domain of BfmR from Acinetobacter baumannii
Class: transcription regulator
Keywords: response regulator, effector domain, TRANSCRIPTION REGULATOR
Deposited on 2016-01-15, released 2017-01-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-01-18, with a file datestamp of 2017-01-13.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcriptional regulatory protein RstA
    Species: Acinetobacter baumannii [TaxId:575584]
    Gene: rstA, F911_03224, HMPREF0010_01249
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2naza_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2nazA (A:)
    medevaqriefddlvidnggrsvtlngelvdftsaeydllwllasnagrilsrediferl
    rgieydgqdrsidvrisrirpkigddpenpkriktvrskgylfvketngllehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nazA (A:)
    edevaqriefddlvidnggrsvtlngelvdftsaeydllwllasnagrilsrediferlr
    gieydgqdrsidvrisrirpkigddpenpkriktvrskgylfvketngl