PDB entry 2nad

View 2nad on RCSB PDB site
Description: high resolution structures of holo and apo formate dehydrogenase
Deposited on 1994-07-06, released 1995-01-26
The last revision prior to the SCOP 1.63 freeze date was dated 1995-01-26, with a file datestamp of 1995-02-03.
Experiment type: -
Resolution: 2 Å
R-factor: 0.114
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2nadA (A:)
    akvlcvlyddpvdgypktyarddlpkidhypggqtlptpkaidftpgqllgsvsgelglr
    kylesnghtlvvtsdkdgpdsvferelvdadvvisqpfwpayltperiakaknlklalta
    gigsdhvdlqsaidrnvtvaevtycnsisvaehvvmmilslvrnylpshewarkggwnia
    dcvshaydleamhvgtvaagriglavlrrlapfdvhlhytdrhrlpesvekelnltwhat
    redmypvcdvvtlncplhpetehmindetlklfkrgayivntargklcdrdavaralesg
    rlagyagdvwfpqpapkdhpwrtmpyngmtphisgttltaqaryaagtreilecffegrp
    irdeylivqggalagtgahsyskgnatggse
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2nadB (B:)
    akvlcvlyddpvdgypktyarddlpkidhypggqtlptpkaidftpgqllgsvsgelglr
    kylesnghtlvvtsdkdgpdsvferelvdadvvisqpfwpayltperiakaknlklalta
    gigsdhvdlqsaidrnvtvaevtycnsisvaehvvmmilslvrnylpshewarkggwnia
    dcvshaydleamhvgtvaagriglavlrrlapfdvhlhytdrhrlpesvekelnltwhat
    redmypvcdvvtlncplhpetehmindetlklfkrgayivntargklcdrdavaralesg
    rlagyagdvwfpqpapkdhpwrtmpyngmtphisgttltaqaryaagtreilecffegrp
    irdeylivqggalagtgahsysk