PDB entry 2nad

View 2nad on RCSB PDB site
Description: high resolution structures of holo and apo formate dehydrogenase
Class: oxidoreductase(aldehyde(d),nad+(a))
Keywords: oxidoreductase(aldehyde(d),nad+(a))
Deposited on 1994-07-06, released 1995-01-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.114
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nad-dependent formate dehydrogenase
    Species: Pseudomonas sp. [TaxId:33067]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2nada1, d2nada2
  • Chain 'B':
    Compound: nad-dependent formate dehydrogenase
    Species: Pseudomonas sp. [TaxId:33067]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2nadb1, d2nadb2
  • Heterogens: AZI, SO4, NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2nadA (A:)
    akvlcvlyddpvdgypktyarddlpkidhypggqtlptpkaidftpgqllgsvsgelglr
    kylesnghtlvvtsdkdgpdsvferelvdadvvisqpfwpayltperiakaknlklalta
    gigsdhvdlqsaidrnvtvaevtycnsisvaehvvmmilslvrnylpshewarkggwnia
    dcvshaydleamhvgtvaagriglavlrrlapfdvhlhytdrhrlpesvekelnltwhat
    redmypvcdvvtlncplhpetehmindetlklfkrgayivntargklcdrdavaralesg
    rlagyagdvwfpqpapkdhpwrtmpyngmtphisgttltaqaryaagtreilecffegrp
    irdeylivqggalagtgahsyskgnatggseea
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nadA (A:)
    akvlcvlyddpvdgypktyarddlpkidhypggqtlptpkaidftpgqllgsvsgelglr
    kylesnghtlvvtsdkdgpdsvferelvdadvvisqpfwpayltperiakaknlklalta
    gigsdhvdlqsaidrnvtvaevtycnsisvaehvvmmilslvrnylpshewarkggwnia
    dcvshaydleamhvgtvaagriglavlrrlapfdvhlhytdrhrlpesvekelnltwhat
    redmypvcdvvtlncplhpetehmindetlklfkrgayivntargklcdrdavaralesg
    rlagyagdvwfpqpapkdhpwrtmpyngmtphisgttltaqaryaagtreilecffegrp
    irdeylivqggalagtgahsyskgnatggse
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2nadB (B:)
    akvlcvlyddpvdgypktyarddlpkidhypggqtlptpkaidftpgqllgsvsgelglr
    kylesnghtlvvtsdkdgpdsvferelvdadvvisqpfwpayltperiakaknlklalta
    gigsdhvdlqsaidrnvtvaevtycnsisvaehvvmmilslvrnylpshewarkggwnia
    dcvshaydleamhvgtvaagriglavlrrlapfdvhlhytdrhrlpesvekelnltwhat
    redmypvcdvvtlncplhpetehmindetlklfkrgayivntargklcdrdavaralesg
    rlagyagdvwfpqpapkdhpwrtmpyngmtphisgttltaqaryaagtreilecffegrp
    irdeylivqggalagtgahsyskgnatggseea
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nadB (B:)
    akvlcvlyddpvdgypktyarddlpkidhypggqtlptpkaidftpgqllgsvsgelglr
    kylesnghtlvvtsdkdgpdsvferelvdadvvisqpfwpayltperiakaknlklalta
    gigsdhvdlqsaidrnvtvaevtycnsisvaehvvmmilslvrnylpshewarkggwnia
    dcvshaydleamhvgtvaagriglavlrrlapfdvhlhytdrhrlpesvekelnltwhat
    redmypvcdvvtlncplhpetehmindetlklfkrgayivntargklcdrdavaralesg
    rlagyagdvwfpqpapkdhpwrtmpyngmtphisgttltaqaryaagtreilecffegrp
    irdeylivqggalagtgahsysk