PDB entry 2n9u

View 2n9u on RCSB PDB site
Description: Solution NMR structure of Erythrobacter litoralis PhyR response regulator REC domain
Class: transcription
Keywords: Response Regulator, Receiver, Two-component signaling, TRANSCRIPTION
Deposited on 2015-12-09, released 2016-09-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-12-28, with a file datestamp of 2016-12-22.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Response regulator
  Species: Erythrobacter litoralis HTCC2594 [TaxId:314225]
  Gene: ELI_10215
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q2N856 (4-128)
    • expression tag (0-3)
  Domains in SCOPe 2.07: d2n9ua1, d2n9ua2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2n9uA (A:)
  gamgstnvliiedeplismqledlvrslghdiagtaatrtqaqeavakekpglvladiql
  adgssgidavedilgqfdvpvifitayperlltgdrpeptylvtkpfqestvrttisqal
  ffqnsptav