PDB entry 2n9d

View 2n9d on RCSB PDB site
Description: Structure analysis of the Tom1 GAT domain reveals distinct ligand-specific conformational states
Class: transport protein
Keywords: TRANSPORT PROTEIN, Tom1, early endosomes, alternative ESCRT-0 member, cargo
Deposited on 2015-11-15, released 2016-09-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-09-21, with a file datestamp of 2016-09-16.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Target of Myb protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: TOM1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2n9da_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2n9dA (A:)
    gplgseqigklrselemvsgnvrvmsemltelvptqaepadlellqelnrtcramqqrvl
    elipqianeqlteellivndnlnnvflrherferfrtgqt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2n9dA (A:)
    eqigklrselemvsgnvrvmsemltelvptqaepadlellqelnrtcramqqrvlelipq
    ianeqlteellivndnlnnvflrherferfrtgqt