PDB entry 2n8r

View 2n8r on RCSB PDB site
Description: Productive complex between MMP-12 and synthetic triple-helical collagen, revealed through paramagnetic NMR
Class: hydrolase/structural protein
Keywords: Collagenolysis, matrix petalloproteinase, HYDROLASE-STRUCTURAL PROTEIN complex
Deposited on 2015-10-24, released 2016-02-24
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-03-16, with a file datestamp of 2016-03-11.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Macrophage metalloelastase
    Species: Homo sapiens [TaxId:9606]
    Gene: MMP12, HME
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2n8ra_
  • Chain 'B':
    Compound: Collagen triple helix repeat family protein
    Database cross-references and differences (RAF-indexed):
    • PDB 2N8R
  • Chain 'C':
    Compound: Collagen triple helix repeat family protein
    Database cross-references and differences (RAF-indexed):
    • PDB 2N8R
  • Chain 'D':
    Compound: Collagen triple helix repeat family protein
    Database cross-references and differences (RAF-indexed):
    • PDB 2N8R (0-35)
  • Heterogens: ZN, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2n8rA (A:)
    frempggpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadi
    lvvfargahgdfhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavhe
    ighslglghssdpkavmfptykyvdintfrlsaddirgiqslyg
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.