PDB entry 2n88

View 2n88 on RCSB PDB site
Description: Chromodomain 3 (CD3) of cpSRP43
Class: protein binding
Keywords: chromodomain, SRP, plant signaling, membrane trafficking, cpSRP, PROTEIN BINDING
Deposited on 2015-10-06, released 2015-12-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2015-12-09, with a file datestamp of 2015-12-04.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Signal recognition particle 43 kDa protein, chloroplastic
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: CAO, CPSRP43, At2g47450, T30B22.25
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2n88a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2n88A (A:)
gleyavaesvigkrvgddgktieylvkwtdmsdatwepqdnvdstlvllyqqqqpmne