PDB entry 2n80

View 2n80 on RCSB PDB site
Description: p75NTR DD:RhoGDI
Class: signaling protein
Keywords: RhoGDI, p75NTR, death domain, SIGNALING PROTEIN
Deposited on 2015-09-30, released 2015-12-23
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-12-23, with a file datestamp of 2015-12-18.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tumor necrosis factor receptor superfamily member 16
    Species: Homo sapiens [TaxId:9606]
    Gene: Ngfr, Tnfrsf16
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2n80a_
  • Chain 'B':
    Compound: rho GDP-dissociation inhibitor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: ARHGDIA, GDIA1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2n80b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2n80A (A:)
glysslppakreevekllngsagdtwrhlagelgyqpehidsftheacpvrallaswatq
dsatldallaalrriqradlveslcsestatspv

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2n80B (B:)
aqksiqeiqeldkddeslrkykeallgrvavsadpnvpnvvvtgltlvcssapgpleldl
tgdlesfkkqsfvlkegveyrikisfrvnreivsgmkyiqhtyrkgvkidktdymvgsyg
praeeyefltpveeapkgmlargsysiksrftdddktdhlswewnltikkdwkd