PDB entry 2n7y

View 2n7y on RCSB PDB site
Description: NMR structure of metal-binding domain 1 of ATP7B
Class: metal binding protein
Keywords: copper binding, hydrolase, METAL BINDING PROTEIN
Deposited on 2015-09-27, released 2016-09-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-02-14, with a file datestamp of 2018-02-09.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Copper-transporting ATPase 2
  Species: Homo sapiens [TaxId:9606]
  Gene: ATP7B, PWD, WC1, WND
  Database cross-references and differences (RAF-indexed):
  • Uniprot P35670 (4-75)
    • expression tag (0-3)
  Domains in SCOPe 2.08: d2n7ya1, d2n7ya2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2n7yA (A:)
  aghmqvatstvrilgmtcqscvksiedrisnlkgiismkvsleqgsatvkyvpsvvclqq
  vchqigdmgfeasiae