PDB entry 2n7y

View 2n7y on RCSB PDB site
Description: NMR structure of metal-binding domain 1 of ATP7B
Class: metal binding protein
Keywords: copper binding, hydrolase, METAL BINDING PROTEIN
Deposited on 2015-09-27, released 2016-09-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-09-28, with a file datestamp of 2016-09-23.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Copper-transporting ATPase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: ATP7B, PWD, WC1, WND
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35670 (4-75)
      • expression tag (0-3)
    Domains in SCOPe 2.06: d2n7ya1, d2n7ya2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2n7yA (A:)
    aghmqvatstvrilgmtcqscvksiedrisnlkgiismkvsleqgsatvkyvpsvvclqq
    vchqigdmgfeasiae