PDB entry 2n79

View 2n79 on RCSB PDB site
Description: The structural and functional effects of the Familial Hypertrophic Cardiomyopathy-linked cardiac troponin C mutation, L29Q
Class: contractile protein
Keywords: Cardiac, CONTRACTILE PROTEIN
Deposited on 2015-09-06, released 2015-10-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-10-28, with a file datestamp of 2015-10-23.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'C':
    Compound: troponin c, slow skeletal and cardiac muscles
    Species: Homo sapiens [TaxId:9606]
    Gene: TNNC1, TNNC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63316 (0-88)
      • engineered mutation (28)
      • engineered mutation (34)
      • engineered mutation (83)
    Domains in SCOPe 2.07: d2n79c_
  • Heterogens: CA

PDB Chain Sequences:

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2n79C (C:)
    mddiykaaveqlteeqknefkaafdifvqgaedgsistkelgkvmrmlgqnptpeelqem
    idevdedgsgtvdfdeflvmmvrsmkdds