PDB entry 2n78

View 2n78 on RCSB PDB site
Description: NMR structure of IF1 from Pseudomonas aeruginosa
Class: translation
Keywords: translation
Deposited on 2015-09-04, released 2016-09-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-09-07, with a file datestamp of 2016-09-02.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Translation initiation factor IF-1
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: infA, ERS445055_02430, PA257_2936, PA8380_26730, PAMH19_6240, YQ19_15045
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2n78a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2n78A (A:)
    mskedsfemegtvvdtlpntmfrvelenghvvtahisgkmrknyiriltgdkvrveltpy
    dlskgrityrar