PDB entry 2n71

View 2n71 on RCSB PDB site
Description: NMR structure of CmPI-II, a serin protease inhibitor isolated from mollusk Cenchitis muricatus
Class: hydrolase inhibitor
Keywords: non-classical Kazal-inhibitor, HYDROLASE INHIBITOR
Deposited on 2015-09-01, released 2016-09-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-10-21, with a file datestamp of 2020-10-16.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Protease inhibitor 2
  Species: Cenchritis muricatus [TaxId:197001]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P84755 (0-49)
  Domains in SCOPe 2.08: d2n71a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2n71A (A:)
  aedcvgrkactrewypvcgsdgvtysnpcnfsaqqeqcdpnitiahmgec