PDB entry 2n69

View 2n69 on RCSB PDB site
Description: NMR structure of non-sweet mutant (ins18RI19) of sweet protein Brazzein
Class: plant protein
Keywords: Brazzein, Sweet protein, PLANT PROTEIN
Deposited on 2015-08-14, released 2016-08-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-11, with a file datestamp of 2019-12-06.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Defensin-like protein
  Species: Pentadiplandra brazzeana [TaxId:43545]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P56552 (0-55)
    • insertion (18-19)
  Domains in SCOPe 2.08: d2n69a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2n69A (A:)
  qdkckkvyenypvskcqlrianqcnydckldkharsgecfydekrnlqcicdycey