PDB entry 2n5z

View 2n5z on RCSB PDB site
Description: Mycobacterium tuberculosis: a dynamic view of the resuscitation promoting factor RpfC catalytic domain
Class: hydrolase
Keywords: resuscitation promoting factor, RpfC, HYDROLASE
Deposited on 2015-08-07, released 2015-11-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2015-12-16, with a file datestamp of 2015-12-11.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Resuscitation-promoting factor RpfC
  Species: Mycobacterium tuberculosis [TaxId:83332]
  Gene: MTCY180.34, rpfC, Rv1884c
  Database cross-references and differences (RAF-indexed):
  • Uniprot O07747 (3-81)
    • expression tag (0-2)
  Domains in SCOPe 2.08: d2n5za1, d2n5za2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2n5zA (A:)
  gamgpspnwdavaqcesggnwaantgngkygglqfkpatwaafggvgnpaaasreqqiav
  anrvlaeqgldawptcgaasgl