PDB entry 2n55

View 2n55 on RCSB PDB site
Description: Structure of constitutively monomeric CXCL12 in complex with the CXCR4 N-terminus
Class: CYTOKINE/Signaling Protein
Keywords: CXL12, CXCR4, chemokine, GPCR, SDF1, CYTOKINE-Signaling Protein complex
Deposited on 2015-07-07, released 2016-04-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-05-03, with a file datestamp of 2017-04-28.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Stromal cell-derived factor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: CXCL12, SDF1, SDF1A, SDF1B
    Database cross-references and differences (RAF-indexed):
    • Uniprot P48061 (2-69)
      • expression tag (0-1)
      • engineered mutation (56)
      • engineered mutation (59)
    Domains in SCOPe 2.08: d2n55a1, d2n55a2
  • Chain 'B':
    Compound: C-X-C chemokine receptor type 4
    Species: Homo sapiens [TaxId:9606]
    Gene: CXCR4
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61073 (2-39)
      • expression tag (0-1)
      • engineered mutation (29)

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2n55A (A:)
gmkpvslsyrcpcrffeshvaranvkhlkilntpncalqivarlknnnrqvcidpkckwc
qeylekalnk

  • Chain 'B':
    No sequence available.