PDB entry 2n54

View 2n54 on RCSB PDB site
Description: Solution structure of a disulfide stabilized XCL1 dimer
Class: cytokine
Keywords: XCL1, dimer,Chemokine, metamorphic, GAG-binding, HIV-1 inhibition, Lymphotactin, ATAC, CYTOKINE
Deposited on 2015-07-07, released 2015-10-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-12-02, with a file datestamp of 2015-11-27.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lymphotactin
    Species: Homo sapiens [TaxId:9606]
    Gene: XCL1, LTN, SCYC1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P47992
      • engineered mutation (35)
      • engineered mutation (48)
    Domains in SCOPe 2.07: d2n54a_
  • Chain 'B':
    Compound: Lymphotactin
    Species: Homo sapiens [TaxId:9606]
    Gene: XCL1, LTN, SCYC1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P47992 (0-End)
      • engineered mutation (35)
      • engineered mutation (48)
    Domains in SCOPe 2.07: d2n54b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2n54A (A:)
    vgsevsdkrtcvslttqrlpvsriktytitegslrcvifitkrglkvccdpqatwvrdvv
    rsmdrksntrnnmiqtkptgtqqstntavtltg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2n54A (A:)
    vgsevsdkrtcvslttqrlpvsriktytitegslrcvifitkrglkvccdpqatwvrdvv
    rsmdrk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2n54B (B:)
    vgsevsdkrtcvslttqrlpvsriktytitegslrcvifitkrglkvccdpqatwvrdvv
    rsmdrksntrnnmiqtkptgtqqstntavtltg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2n54B (B:)
    vgsevsdkrtcvslttqrlpvsriktytitegslrcvifitkrglkvccdpqatwvrdvv
    rsmdrk