PDB entry 2n4w

View 2n4w on RCSB PDB site
Description: NMR structure of Fbp28 WW domain T456Y mutant
Class: transcription
Keywords: WW domain, TRANSCRIPTION
Deposited on 2015-07-01, released 2015-10-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2015-11-18, with a file datestamp of 2015-11-13.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Transcription elongation regulator 1
  Species: Homo sapiens [TaxId:9606]
  Gene: TCERG1, CA150, TAF2S
  Database cross-references and differences (RAF-indexed):
  • Uniprot O14776 (0-36)
    • engineered mutation (28)
  Domains in SCOPe 2.08: d2n4wa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2n4wA (A:)
  gatavsewteyktadgktyyynnrtlesywekpqelk