PDB entry 2n4u

View 2n4u on RCSB PDB site
Description: NMR structure of Fbp28 WW domain E454Y mutant
Class: transcription
Keywords: WW domain, TRANSCRIPTION
Deposited on 2015-07-01, released 2015-10-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2015-11-18, with a file datestamp of 2015-11-13.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcription elongation regulator 1
    Species: Homo sapiens [TaxId:9606]
    Gene: TCERG1, CA150, TAF2S
    Database cross-references and differences (RAF-indexed):
    • Uniprot O14776 (0-36)
      • engineered mutation (26)
    Domains in SCOPe 2.08: d2n4ua_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2n4uA (A:)
    gatavsewteyktadgktyyynnrtlystwekpqelk