PDB entry 2n4i

View 2n4i on RCSB PDB site
Description: The solution structure of Skint-1, a critical determinant of dendritic epidermal gamma-delta T cell selection
Class: signaling protein
Keywords: Immune stress surveillance, thymic organ culture, SIGNALING PROTEIN
Deposited on 2015-06-18, released 2016-03-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2016-05-11, with a file datestamp of 2016-05-06.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Selection and upkeep of intraepithelial T-cells protein 1
  Species: Mus musculus [TaxId:10090]
  Gene: Skint1
  Database cross-references and differences (RAF-indexed):
  • Uniprot A7TZE6 (1-118)
    • initiating methionine (0)
  Domains in SCOPe 2.08: d2n4ia_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2n4iA (A:)
  mssepfivnglegpvlaslggnlelscqlsppqqaqhmeirwfrnlytepvhlyrdgkdm
  fgeiiskyvertellkdgigegkvtlrifnvtvdddgsyhcvfkdgdfyeehitevkit