PDB entry 2n46

View 2n46 on RCSB PDB site
Description: EC-NMR Structure of Human H-RasT35S mutant protein Determined by Combining Evolutionary Couplings (EC) and Sparse NMR Data
Class: signaling protein
Keywords: EC-NMR, NORTHEAST STRUCTURAL GENOMICS CONSORTIUM, NESG, Protein Structure Initiative, PSI-Biology, Structural Genomics, SIGNALING PROTEIN
Deposited on 2015-06-17, released 2015-07-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-08-12, with a file datestamp of 2015-08-07.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: gtpase hras
    Species: Homo sapiens [TaxId:9606]
    Gene: HRAS, HRAS1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01112 (6-171)
      • engineered mutation (40)
    Domains in SCOPe 2.07: d2n46a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2n46A (A:)
    gplgsdmteyklvvvgaggvgksaltiqliqnhfvdeydpsiedsyrkqvvidgetclld
    ildtagqeeysamrdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlv
    gnkcdlaartvesrqaqdlarsygipyietsaktrqgvedafytlvreirqh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2n46A (A:)
    mteyklvvvgaggvgksaltiqliqnhfvdeydpsiedsyrkqvvidgetclldildtag
    qeeysamrdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnkcdl
    aartvesrqaqdlarsygipyietsaktrqgvedafytlvreirqh