PDB entry 2n2z

View 2n2z on RCSB PDB site
Description: NMR spatial structure of nonspecific lipid transfer protein from the dill Anethum graveolens L.
Class: plant protein
Keywords: lipid transfer protein, plant defense protein, PLANT PROTEIN
Deposited on 2015-05-19, released 2016-03-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2016-03-30, with a file datestamp of 2016-03-25.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Non-specific lipid-transfer protein
  Species: Anethum graveolens [TaxId:40922]
  Database cross-references and differences (RAF-indexed):
  • Uniprot A0A0B4JDK1 (0-92)
  Domains in SCOPe 2.08: d2n2za_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2n2zA (A:)
  ltcgqvtgalapclgylrtagsvpvpltccngvrglnnaarttidrrtacnclkqtanai
  adlnlnaaaglpakcgvnipykispstdcnrvv