PDB entry 2n2n

View 2n2n on RCSB PDB site
Description: Tom1 negatively modulates binding of Tollip to phosphatidylinositol 3-phosphate via a coupled folding and binding mechanism
Class: protein transport
Keywords: protein transport
Deposited on 2015-05-11, released 2015-09-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2015-10-21, with a file datestamp of 2015-10-16.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Target of Myb protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: TOM1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2n2na_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2n2nA (A:)
gplgseqigklrselemvsgnvrvmsemltelvptqaepadlellqelnrtcramqqrvl
elipqianeqlteellivndnlnnvflrherferfrtgqt

    Sequence, based on observed residues (ATOM records): (download) 
    >2n2nA (A:)
eqigklrselemvsgnvrvmsemltelvptqaepadlellqelnrtcramqqrvlelipq
ianeqlteellivndnlnnvflrherferfrtgqt