PDB entry 2n2m

View 2n2m on RCSB PDB site
Description: NMR structure of yersinia pestis Ail (attachment invasion locus) in decylphosphocholine micelles
Class: membrane protein
Keywords: membrane protein
Deposited on 2015-05-10, released 2015-07-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-10-07, with a file datestamp of 2015-10-02.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Outer membrane protein X
    Species: Yersinia pestis [TaxId:632]
    Gene: ompX, y1324
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2n2ma_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2n2mA (A:)
    egessisigyaqsrvkedgykldknprgfnlkyryefnndwgvigsfaqtrrgfeesvdg
    fklidgdfkyysvtagpvfrineyvslygllgaghgkakfssifgqsesrsktslaygag
    lqfnphpnfvidasyeysklddvkvgtwmlgagyrf