PDB entry 2n26

View 2n26 on RCSB PDB site
Description: Solution structure of Miz-1 zinc fingers 3 and 4
Class: DNA binding protein
Keywords: Miz-1, ZBTB17, C2H2 zinc finger, DNA BINDING PROTEIN
Deposited on 2015-04-28, released 2015-06-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2016-08-10, with a file datestamp of 2016-08-05.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Zinc finger and BTB domain-containing protein 17
    Species: Homo sapiens [TaxId:9606]
    Gene: MIZ1, ZBTB17, ZNF151, ZNF60
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2n26a_
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2n26A (A:)
    mvihkcedcgkefthtgnfkrhirihtgekpfscrecskafsdpaackahekthsplkpy
    gceecgksyrlisllnlhkkrhsgearyrcedcgklfttsgnlkrhqlvhsg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2n26A (A:)
    kpygceecgksyrlisllnlhkkrhsgearyrcedcgklfttsgnlkrhqlvhsg