PDB entry 2n23

View 2n23 on RCSB PDB site
Description: NMR structure of the complex between the PH domain of the Tfb1 subunit from TFIIH and the N-terminal activation domain of EKLF (TAD1)
Class: transcription
Keywords: Transcription factor TFIIH, Transactivation domain, Erythroid Kr ppel-like factor 1, Transcriptional activation, p62/Tfb1 subunit, TRANSCRIPTION
Deposited on 2015-04-27, released 2016-04-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2016-04-27, with a file datestamp of 2016-04-22.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RNA polymerase II transcription factor B subunit 1
    Species: Saccharomyces cerevisiae S288c [TaxId:559292]
    Gene: TFB1, YDR311W, D9740.3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32776 (1-114)
      • expression tag (0)
    Domains in SCOPe 2.08: d2n23a1, d2n23a2
  • Chain 'B':
    Compound: Krueppel-like factor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: KLF1, EKLF
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2n23A (A:)
pshsgaaifekvsgiiainedvspaeltwrstdgdkvhtvvlstidklqatpassekmml
rligkvdeskkrkdnegnevvpkpqrhmfsfnnrtvmdnikmtlqqiisrykdad

  • Chain 'B':
    No sequence available.