PDB entry 2n1w

View 2n1w on RCSB PDB site
Description: Solution structure of human SUMO2
Class: structural genomics
Keywords: Ubiquitin-like protein, STRUCTURAL GENOMICS
Deposited on 2015-04-24, released 2016-04-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2016-04-20, with a file datestamp of 2016-04-15.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Small ubiquitin-related modifier 2
    Species: Homo sapiens [TaxId:9606]
    Gene: SMT3B, SMT3H2, SUMO2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2n1wa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2n1wA (A:)
    mgsshhhhhhsqdpmadekpkegvktenndhinlkvagqdgsvvqfkikrhtplsklmka
    ycerqglsmrqirfrfdgqpinetdtpaqlemededtidvfqqqtgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2n1wA (A:)
    madekpkegvktenndhinlkvagqdgsvvqfkikrhtplsklmkaycerqglsmrqirf
    rfdgqpinetdtpaqlemededtidvfqqqtgg