PDB entry 2n1a

View 2n1a on RCSB PDB site
Description: Docked structure between SUMO1 and ZZ-domain from CBP
Class: transcription
Keywords: protein-protein complex, docked structure, SUMO1, SIM, ZZ-domain, TRANSCRIPTION
Deposited on 2015-03-26, released 2016-05-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-06-22, with a file datestamp of 2016-06-17.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Small ubiquitin-related modifier 1
  Species: Homo sapiens [TaxId:9606]
  Gene: OK/SW-cl.43, SMT3C, SMT3H3, SUMO1, UBL1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P63165 (2-102)
    • expression tag (0-1)
  Domains in SCOPe 2.07: d2n1aa1, d2n1aa2
• Chain 'B':
  Compound: creb-binding protein
  Species: Homo sapiens [TaxId:9606]
  Gene: CBP, CREBBP
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q92793 (0-52)
  Domains in SCOPe 2.07: d2n1ab_
• Heterogens: ZN

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2n1aA (A:)
  gsmsdqeakpstedlgdkkegeyiklkvigqdsseihfkvkmtthlkklkesycqrqgvp
  mnslrflfegqriadnhtpkelgmeeedvievyqeqtgghstv
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2n1aB (B:)
  gqdrfvytcneckhhvetrwhctvcedydlcincyntkshahkmvkwglgldd