PDB entry 2n1a

View 2n1a on RCSB PDB site
Description: Docked structure between SUMO1 and ZZ-domain from CBP
Class: transcription
Keywords: protein-protein complex, docked structure, SUMO1, SIM, ZZ-domain, TRANSCRIPTION
Deposited on 2015-03-26, released 2016-05-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-05-04, with a file datestamp of 2016-04-29.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Small ubiquitin-related modifier 1
    Species: Homo sapiens [TaxId:9606]
    Gene: OK/SW-cl.43, SMT3C, SMT3H3, SUMO1, UBL1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63165 (2-102)
      • expression tag (0-1)
    Domains in SCOPe 2.06: d2n1aa1, d2n1aa2
  • Chain 'B':
    Compound: creb-binding protein
    Species: Homo sapiens [TaxId:9606]
    Gene: CBP, CREBBP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2n1ab_
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2n1aA (A:)
    gsmsdqeakpstedlgdkkegeyiklkvigqdsseihfkvkmtthlkklkesycqrqgvp
    mnslrflfegqriadnhtpkelgmeeedvievyqeqtgghstv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2n1aB (B:)
    gqdrfvytcneckhhvetrwhctvcedydlcincyntkshahkmvkwglgldd